python 2.7 - Hashed or random values getting inserted in google cloud datastore -

- 

task = datastore.entity(client.key('modeldatatest', prod_id))         task.update({             'productid': '1234',             'listofrankedrelevantitems.productid': ['345', '456','567'],             'listofrankedrelevantitems.similarityscore': ['0.98', '0.89','0.77']         })         client.put(task)

using above code i'm creating entity in gc-datastore i'm getting prod_id blob 'mtizndu=' instead of string '1234' , productid ["mzix","mzq1","ndu2"] instead of ['345', '456','567'] , similarityscore ["mc45oa==","mc44nw==","mc43nw=="] instead of ['0.98', '0.89','0.77'] 1 having idea why , how proper values.

the issue in python 2 string represented bytestream , have convert unicode see results in gcloud datastore. use unicode() method solve issue.


Comments

Post a Comment

Popular posts from this blog

Failed to execute goal org.apache.maven.plugins:maven-surefire-plugin:2.12:test (default-test) on project.Error occurred in starting fork -

-
i searched on internet provided answers did not in building project. the error starting fork. tried following methods: mvn clean install -u when searched, people said because of java 7 , should work java 6. using java 6 only. some said set surefire plugin this: <groupid>org.apache.maven.plugins</groupid> <artifactid>maven-surefire-plugin</artifactid> <version>2.5</version> <configuration> <skiptests>false</skiptests> <testfailureignore>true</testfailureignore> <forkmode>once</forkmode> </configuration> the actual error is: [error] failed execute goal org.apache.maven.plugins:maven-surefire-plugin:2.12:test (default-test) on project junitcategorizer.instrument: error occurred in starting fork, check output in log -> [help 1] org.apache.maven.lifecycle.lifecycleexecutionexception: failed execute goal org.apache.maven.plugins:maven-surefire-plugin:2...
Read more

windows - Debug iNetMgr.exe unhandle exception System.Management.Automation.CmdletInvocationException -

-
i fired windows 7 machine today , attempting start intemgr.exe process terminates immediately. started process under debugger. seems process terminating following exception: system.management.automation.cmdletinvocationexception . dumping exceptions on heap yields following results. heap has few more exception listed below. so based on research exception happens when cmdlet encounters terminating error. method call before processrecord(). provides record-by-record processing functionality cmdlet. windows powershell runtime calls method multiple times each instance of cmdlet in pipeline. how can inspect pipeline debugger? exception object: 0000000002702940 exception type: system.management.automation.itemnotfoundexception message: cannot find path 'c:\windows\system32\windowspowershell\v1.0\modules\applicationserver\applicationserver.dll' because not exist. innerexception: <none> stacktrace (generated): sp ip function 000000001...
Read more

configurationsection - activeMq-5.13.3 setup configurations for wildfly 10.0.0 -

-
hi new work on activemq, trying access messages send activemq in mdb onmsg() method unable things done here sample standalone-full.xml configuration. <subsystem xmlns="urn:jboss:domain:messaging-activemq:1.0"> <jms-queue name="favouritesqueue" entries="queue/favouritesqueue"/> </server> </subsystem> mdb configuration <mdb> <resource-adapter-ref resource-adapter-name="activemq-ra.rar"/> <bean-instance-pool-ref pool-name="mdb-strict-max-pool"/> </mdb> <subsystem xmlns="urn:jboss:domain:resource-adapters:4.0"> <resource-adapters> <resource-adapter id="activemq-ra.rar"> <archive> activemq-rar-5.13.3.rar </archive> <transaction-support>xatr...
Read more